Total number of results for Erinaceus concolor are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03797 |
VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY
|
36 | Erinaceus concolor | NPY | Pancreatic polypeptide | 8234904#Marks NJ, Shaw C, Halton DW, Thim L#The primary structure of pancreatic polypeptide from a primitive insectivorous mammal, the European hedgehog (Erinaceous europaeus)#Regul Pept 1993 Sep 3;47(2):179-85 |